PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011480P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 126aa    MW: 14643.7 Da    PI: 10.1127
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011480P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK73.13.5e-233482351
          RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51
                     +++++d+ +y +lpi +A+k+L+vc TvLK+iCR+ G++RWP+Rki+s
  MELO3C011480P1 34 GRMTVNDVWEYLHLPISEASKKLNVCNTVLKKICRRSGLSRWPYRKIRS 82
                    679999*****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.58723103IPR003035RWP-RK domain
PfamPF020422.0E-203682IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MEQTTPDCQN EPPEQPEEQP PRRPSLAAQR QRTGRMTVND VWEYLHLPIS EASKKLNVCN  60
TVLKKICRRS GLSRWPYRKI RSYERRIAAL RATMNSSYGD TRVRAEAEIE RVQKELADFC  120
ARIRI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818232e-79LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132572e-79LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445526.15e-86PREDICTED: protein RKD2-like isoform X1
TrEMBLA0A0A0KGT81e-70A0A0A0KGT8_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.16e-13RWP-RK domain-containing protein